Mnemonic major system


The major system is a mnemonic technique used to aid in memorizing numbers.
The system works by converting numbers into consonant sounds, then into words by adding vowels. The system works on the principle that images can be remembered more easily than numbers.
One notable explanation of this system was given in Martin Gardner's book The First Scientific American Book of Mathematical Puzzles and Diversions, which has since been republished in The New Martin Gardner Mathematical Library as Hexaflexagons, Probability Paradoxes, and the Tower of Hanoi. In this, Gardner incorrectly attributes the system to Lewis Carroll.

The system

Each numeral is associated with one or more consonant sounds. Strictly speaking it is the sound that each consonant makes that determines its value, not the consonant letter itself, so be aware that the C in "case", the C in "Cello", and the C in "Cynthia" each have different values in the system, not 712. Double letters are disregarded when not pronounced separately, e.g. muddy encodes 31, not 311, but midday encodes 311 while accept encodes 7091 since the ds and cs are pronounced separately. x encodes 70 when pronounced as /ks/ or /gz/ and 76 when pronounced /kS/ or /gZ/ ; z encodes 10 when pronounced /ts/. In ghost and enough, gh is being encoded by different numerals. Usually, a rhotic accent is assumed, e.g. fear would encode 84 rather than 8.
Often the mapping is compact. Hindquarters, for example, translates unambiguously to 2174140, which amounts to seven digits encoded by eight letters, and can be easily visualized.
Each numeral maps to a set of similar sounds with similar mouth and tongue positions.
For most people it would be easier to remember 3.1415927 as:
Short term visual memory of imagined scenes allows large numbers of digits to be memorized with ease, though usually only for a short time.
Whilst this is unwieldy at first, with practice it can become a very effective technique. Longer-term memory may require the formulation of more object-related mnemonics with greater logical connection, perhaps forming grammatical sentences that apply to the matter rather than just strings of images.
The system can be employed with phone numbers. One would typically make up multiple words, preferably a sentence, or an ordered sequence of images featuring the owner of the number.
The Major System can be combined with a peg system for remembering lists, and is sometimes used also as a method of generating the pegs. It can also be combined with other memory techniques such as rhyming, substitute words, or the method of loci. Repetition and concentration using the ordinary memory is still required.
An advantage of the major system is that it is possible to use a computer to automatically translate the number into a set of words. One can then pick the best of several alternatives. Such programs include "Numzi" "Rememberg" "Fonbee", the freeware "2Know", and the website "pinfruit".

Example words

Some of these example words may belong to more than one word category.
0123456789
nounhosehathenhomearrowwhaleshoecowhoofpie
verbsewhateknowaimrowhealchewhookviewbuy
adjectiveeasyhotnewyummyhairyoilyitchygayheavyhappy

00010203040506070809
nounsauceseedsunsumosierrasoilsewageskysofasoap
verbassessswatassignassumesorrowsellswitchsoaksavesob
adjectivesissysadsnowyawesomesorryslowswishysicksavvysappy
10111213141516171819
noundaisytattootunadomediarytaildishdogdovetuba
verbteaseeditwidentimedrawtellteachtakedefytype
adjectivedizzytightwoodentamedrytallwhitishthickdeafdeep
20212223242526272829
nounnosenetonionenemywinerynailnachoneckknifehoneybee
verbionizeunitenannynamehonourinhaleenjoyknockenvynab
adjectivenoisyneatneon numbnarrowannualnudgynaggynaivewannabe
30313233343536373839
nounmousemeadowmoonmummyemerymolematchmugmoviemap
verbamusemeetminemimemarrymailmashmockmovemop
adjectivemessymutemeanmummerrymalemushymuckymauvewimpy
40414243444546474849
nounriceroadurinerumaurorarailwayroachragroofrope
verberasereadruinramrearrulereachrakearrivewrap
adjectiverosyreadyrunnyharamrareroyalrichrockyroughripe
50515253545556575859
nounlouseladylionlimelorrylilyleechleglavalip
verbloseletalignloomlurelulllatchlicklovehelp
adjectivelazyelitealienlameleeryloyallushluckyleafyloopy
60616263646566676869
nouncheesecheetahchingemshrewchillicha-chachickchefjeep
verbchasecheatchainjamjurychilljudgecheckachievechop
adjectivechoosychattyshinyshamcherryjollyJewishshakychiefcheap
70717273747576777879
noungoosecatcoingamecrowclaycagecakecavecube
verbkissquoteweakencombcarrykillcoachcookgivecopy
adjectivecosygoodkeengummygreycoolcatchyquickgoofyagape
80818283848586878889
nounvasevideofanovumfairyfoolveggiefigfife vibe
verbfusefightfinefumefryflyfetchfakeviva fob
adjectivefussyfatfunnyfoamyfurryfoulfishyfoggyfavefab
90919293949596979899
nounbossbeadponypumaberrybellpouchbikebeefpipe
verbopposebitebanbombburypeelpatchpokepavepop
adjectivebusybadbonybalmyprobluebushybackpuffybaby

5 digit peg example : 06286
A different memory system, the method of loci, was taught to schoolchildren for centuries, at least until 1584, "when Puritan reformers declared it unholy for encouraging bizarre and irreverent images." The same objection can be made over the major system, with or without the method of loci. Mental images may be easier to remember if they are insulting, violent, or obscene.
Pierre Hérigone was a French mathematician and astronomer and devised the earliest version of the major system. The major system was further developed by Stanislaus Mink von Wennsshein 300 years ago. It was later elaborated upon by other users. In 1730, Richard Grey set forth a complicated system that used both consonants and vowels to represent the digits. In 1808 Gregor von Feinaigle introduced the improvement of representing the digits by consonant sounds.
In 1825 Aimé Paris published the first known version of the major system in its modern form.
In 1844 Francis Fauvel Gouraud delivered a series of lectures introducing his mnemonic system which was based on Aimé Paris' version. The lectures drew some of the largest crowds ever assembled to hear lectures of a "scientific" nature up to that time. This series of lectures was later published as Phreno-Mnemotechny or The Art of Memory in 1845 and his system received wide acclaim. According to Gouraud, Richard Grey indicated that a discussion on Hebrew linguistics in William Beveridge's Institutionum chronotogicarum libri duo, una cum totidem arithmetices chronologicæ libellis inspired him to create his system of mnemotechniques which later evolved in to the major system.
In the 1880s Marcus Dwight Larrowe, alias Silas Holmes, was teaching memory courses in the United States based on the Major System using a third alias Dr. Antoine Loisette. Because he was charging inordinate sums of money for a system which had obviously existed before, George S. Fellows published "Loisette" exposed and included all the material of Larrowe's course which he determined not to be under copyright. The incident was notable enough to gain coverage by way of a book review in the journal Science. A well-known student of Loisette's included Mark Twain whose endorsement Loisette used regularly to sell his course. Following the revelation that he had not originated the system, Larrowe self-published his material under the pseudonym Dr. Antoine Loisette in 1895 and 1896 and it was later re-published by Funk & Wagnalls in 1899.
In the late 1800s Christof Ludwig Poehlmann, a German who had emigrated to the United States, and William Joseph Ennever created and ran a series of booklets and memory courses using the system which resulted in The Pelman Schools, The Pelman Institute, and were generally known as Pelmanism.
Poehlmann eventually moved back to Germany around 1910 where he continued offering his memory courses and training apparently with a focus on language learning. indicated that he studied under him for a year in 1911. Fürst later practiced criminal law in Frankfort in pre-Hitler Germany before fleeing, as a Jew, to Prague where he taught at Masaryk University until emigrating to New York in 1939. In 1939, Fürst published Use your Head followed by How to Remember, which was later reprinted as The Practical Way to Better Memory, and followed up with a series of 12 booklets entitled You Can Remember! A Home Study Course in Memory and Concentration which all extolled the system, which he called the "Basic List" and the "Number System" along with other mnemonic systems. In a 1946 profile in The New Yorker, Bruno indicates that German scholar Conradus Celtes originated the system.
The system described in this article would be re-popularized after 1957 and through the 1980s in several books by Harry Lorayne, a magician and best selling contemporary author on memory. The most popular of the titles featuring the system is The Memory Book: The Classic Guide to Improving Your Memory at Work, at School, and at Play.
This phonetic system had another resurgence in the 1990s thanks to the late night infomercials of Kevin Trudeau who sold a series of tapes called. He also published a similar book Kevin Trudeau's Mega Memory which used this same system with some slight modifications.
The name "Major System" may refer to Major Bartlomiej Beniowski, who published a version of the system in his book, The Anti-Absurd or Phrenotypic English Pronouncing and Orthographical Dictionary.
There is a reasonable historical possibility that the roots of the Major System are entangled with older systems of shorthand. It is certainly the case that the underlying structure of the Major System has a direct overlap with Gregg shorthand, which was a popular shorthand system in the late 1800s and early 1900s.
Phonetic number memorization systems also occur in other parts of the world, such as the Katapayadi system going back to at least the 7th Century in India.

Practice

Memory feats centered around numbers can be performed by experts who have learned a 'vocabulary' of at least 1 image for every 1 and 2 digit number which can be combined to form narratives. To learn a vocabulary of 3 digit numbers is harder because for each extra digit 10 times more images need to be learned, but many mnemonists use a set of 1000 images. Combination of images into a narrative is easier to do rapidly than is forming a coherent, grammatical sentence. This pre-memorisation and practice at forming images reduces the time required to think up a good imaginary object and create a strong memorable impression of it. The best words for this purpose are usually nouns, especially those for distinctive objects which make a strong impression on a variety of senses or which move.
For basic proficiency a large vocabulary of image words isn't really necessary since, when the table above is reliably learned, it is easy to form your own words ad hoc.

Indexing sequences

Mnemonics often center around learning a complete sequence where all objects in that sequence that come before the one you are trying to recall must be recalled first. For instance, using the mnemonic "Richard of York gave battle in vain" to learn the colours of the rainbow; to remember what colour comes after indigo, one would have to recall the whole sequence. For a short sequence this may be trivial; for longer lists, it can become complicated and error-prone.
A good example would be in recalling the 53rd element of the periodic table. It might be possible for some people to construct and then learn a string of 53 or more items which you have substituted for the elements and then to recall them one by one, counting them off as you go, but it would be a great deal easier and less laborious/tedious to directly associate element 53 with, for example, a lime recalling some prior imagining of yours regarding a mishap where lime juice gets into one's eye - "eye" sounding like "I", the symbol for Iodine. This allows for random access directly to the item, without the need for recalling any previous items.
If you were remembering element 54 in the process of recalling the periodic table you could then recall an image for 54, for instance thinking of a friend called "Laura" in the lotus position looking very Zen-like in order to remind yourself that element 54 is Xenon.
This is an example of combining the Major System with the peg system.

Software

*
*