Corticotropin-releasing hormone Corticotropin-releasing hormone is a peptide hormone involved in the stress response . It is a releasing hormone that belongs to corticotropin-releasing factor family . In humans, it is encoded by the CRH gene. Its main function is the stimulation of the pituitary synthesis of ACTH , as part of the HPA Axis . Corticotropin-releasing hormone is a 41-amino acid peptide derived from a 196-amino acid preprohormone. CRH is secreted by the paraventricular nucleus of the hypothalamus in response to stress . Increased CRH production has been observed to be associated with Alzheimer's disease and major depression , and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia . In addition to being produced in the hypothalamus , CRH is also synthesized in peripheral tissues, such as T lymphocytes , and is highly expressed in the placenta . In the placenta, CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition. A recombinant version for diagnostics is called corticorelin .Hormonal actions CRH is produced by parvocellular neuroendocrine cells within the paraventricular nucleus of the hypothalamus and is released at the median eminence from neurosecretory terminals of these neurons into the primary capillary plexus of the hypothalamo-hypophyseal portal system . The portal system carries the CRH to the anterior lobe of the pituitary, where it stimulates corticotropes to secrete adrenocorticotropic hormone and other biologically-active substances. ACTH stimulates the synthesis of cortisol , glucocorticoids , mineralocorticoids and DHEA . In the short term , CRH can suppress appetite, increase subjective feelings of anxiety, and perform other functions like boosting attention. Although the distal action of CRH is immunosuppression via the action of cortisol, CRH itself can actually heighten inflammation , a process being investigated in multiple sclerosis research .Psychopharmacology The CRH-1 receptor antagonist pexacerfont is currently under investigation for the treatment of generalized anxiety disorder . Another CRH-1 antagonist antalarmin has been researched in animal studies for the treatment of anxiety, depression and other conditions, but no human trials with this compound have been carried out. Also, abnormally high levels of CRH have been found in the cerebrospinal fluid of people that have committed suicide . Recent research has linked the activation of the CRH1 receptor with the euphoric feelings that accompany alcohol consumption . A CRH1 receptor antagonist developed by Pfizer , CP-154,526 is under investigation for the potential treatment of alcoholism . Alpha-helical CRH- acts as a CRH antagonist.Role in parturition CRH is also synthesized by the placenta and seems to determine the duration of pregnancy . Levels rise towards the end of pregnancy just before birth and current theory suggests three roles of CRH in parturition: Increases levels of dehydroepiandrosterone directly by action on the fetal adrenal gland , and indirectly via the mother's pituitary gland . DHEA has a role in preparing for and stimulating cervical contractions. Increases prostaglandin availability in uteroplacental tissues. Prostaglandins activate cervical contractions. Prior to parturition it may have a role inhibiting contractions, through increasing cAMP levels in the myometrium. In culture, trophoblast CRH is inhibited by progesterone, which remains high throughout pregnancy. Its release is stimulated by glucocorticoids and catecholamines, which increase prior to parturition lifting this progesterone block.Structure The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al. in 1981. Its full sequence is: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA The rat and human peptides are identical and differ from the ovine sequence only by 7 amino acids . SE EPPISLDLTFHLLREVLEMAR AE QLAQQAHSNRKLME II Role in non-mammalian vertebrates In mammals, studies suggest that CRH has no significant thyrotropic effect. However, in representatives of all non-mammalian vertebrates, it has been found that, in addition to its corticotropic function, CRH has a potent thyrotropic function, acting with TRH to control the thyroid axis.Interactions Corticotropin-releasing hormone has been shown to interact with corticotropin-releasing hormone receptor 1 .
Popular articles Javier Milei - Argentine libertarian economist, author, radio conductor and public speaker sympathetic to the Austrian School of economic thought. He became widely known for his regular ...Jimmy Carter - American politician, philanthropist, and former farmer who served as the 39th president of the United States from 1977 to 1981. A member of the Democratic Party, he previ...UEFA Euro 2024 - The 2024 UEFA European Football Championship , commonly referred to as UEFA Euro 2024 or simply Euro 2024 , will be the 17th edition of the UEFA European Championship, the quadrennial internationa...Argentina - country located mostly in the southern half of South America. Sharing the bulk of the Southern Cone with Chile to the west, the country is also b...Sam Altman - American entrepreneur, investor, programmer, and blogger. He is the former president of Y Combinator and now the CEO of OpenAI. Early life and education. ...Rosalynn Carter - American who served as First Lady of the United States from 1977 to 1981 as the wife of President Jimmy Carter. For decades, she has been a leading advocate for numerou...Next Argentine presidential election - Next Argentine presidential election - presidential election in Argentina....Popular movies The Hunger Games (film) - 2012 American dystopian action thriller science fiction-adventure film directed by Gary Ross and based on Suzanne Collins’s 2008 novel of the same name. It is the first insta...untitled Captain Marvel sequel - part of Marvel Cinematic Universe....Killers of the Flower Moon (film project) - Killers of the Flower Moon - film project in United States of America. It was presented as drama, detective fiction, thriller. The film project starred Leonardo Dicaprio, Robert De Niro. Director of...Five Nights at Freddy's (film) - Five Nights at Freddy's - film published in 2017 in United States of America. Scenarist of the film - Scott Cawthon....Popular video games Minecraft - sandbox video game developed by Mojang Studios. Created by Markus "Notch" Persson in the Java programming language and released as a public alpha for personal computers in 2...Grand Theft Auto V - 2013 action-adventure game developed by Rockstar North and published by Rockstar Games. It is the first main entry in the Grand Theft Auto series since 2008's Grand Theft ...Roblox - online game platform and game creation system that allows users to program games and play games created by other users. Founded by David Baszucki and Erik Cassel in 2004 and released in...Baldur's Gate III - upcoming role-playing video game developed and published by Larian Studios for Microsoft Windows and the Stadia streaming service. It is the third main game in the Baldur's ...Alan Wake - action-adventure video game developed by Remedy Entertainment and published by Microsoft Studios, released for the Xbox 360 and Microsoft Windows. The story follows best-selling thri...Fortnite - online video game developed by Epic Games and released in 2017. It is available in three distinct game mode versions that otherwise share the same general gameplay and game engine: ...Super Mario RPG - is a role-playing video game developed by Square and published by Nintendo for the Super Nintendo Entertainment System in 1996. It was directed by Yoshihiko Maekawa and Chihiro Fujioka and produced by...Popular books Book of Revelation - The Book of Revelation is the final book of the New Testament, and consequently is also the final book of the Christian Bible. Its title is derived from the first word of the Koine Greek text: apok...Book of Genesis - account of the creation of the world, the early history of humanity, Israel's ancestors and the origins...Gospel of Matthew - The Gospel According to Matthew is the first book of the New Testament and one of the three synoptic gospels. It tells how Israel's Messiah, rejected and executed in Israel, pronounces judgement on ...Michelin Guide - Michelin Guides are a series of guide books published by the French tyre company Michelin for more than a century. The term normally refers to the annually published Michelin Red Guide , the oldest...Psalms - The Book of Psalms , commonly referred to simply as Psalms , the Psalter or "the Psalms", is the first book of the Ketuvim , the third section of the Hebrew Bible, and thus a book of th...Ecclesiastes - Ecclesiastes is one of 24 books of the Tanakh , where it is classified as one of the Ketuvim . Originally written c. 450–200 BCE, it is also among the canonical Wisdom literature of the Old Tes...The 48 Laws of Power - non-fiction book by American author Robert Greene. The book...Popular television series The Crown (TV series) - historical drama web television series about the reign of Queen Elizabeth II, created and principally written by Peter Morgan, and produced by Left Bank Pictures and Sony Pictures Tel...Friends - American sitcom television series, created by David Crane and Marta Kauffman, which aired on NBC from September 22, 1994, to May 6, 2004, lasting ten seasons. With an ensemble cast sta...Young Sheldon - spin-off prequel to The Big Bang Theory and begins with the character Sheldon...Modern Family - American television mockumentary family sitcom created by Christopher Lloyd and Steven Levitan for the American Broadcasting Company. It ran for eleven seasons, from September 23...Loki (TV series) - upcoming American web television miniseries created for Disney+ by Michael Waldron, based on the Marvel Comics character of the same name. It is set in the Marvel Cinematic Universe, shar...Game of Thrones - American fantasy drama television series created by David Benioff and D. B. Weiss for HBO. It...Shameless (American TV series) - American comedy-drama television series developed by John Wells which debuted on Showtime on January 9, 2011. It...
OWIKI.org . Text is available under the Creative Commons Attribution-ShareAlike License.